PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_4573_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 373aa    MW: 41521.2 Da    PI: 9.4048
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_4573_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.99.1e-41164241178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +CqvegC++ l +akeyhrrhkvCe+hskap+v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  Neem_4573_f_1 164 RCQVEGCHVALINAKEYHRRHKVCEMHSKAPKVVVLGLEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKSSH 241
                    6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-34159226IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.368162239IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-38163244IPR004333Transcription factor, SBP-box
PfamPF031109.7E-32165238IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MENGGNMFIS ILGNDDRGQS STNNNNHAWE NMWTFNHSRF DFGNSSSLYT TATTAEGETT  60
HITHSDANTS HALLFPHSLH HRHHHKHHSQ SLYAGDGSNL HPDPHLMCLK LGKRHYFEDA  120
TALADGQVAG FSIVKKGKHY YSFGDGVGPS SSPVLVSSTA AVPRCQVEGC HVALINAKEY  180
HRRHKVCEMH SKAPKVVVLG LEQRFCQQCS RFHVVSEFDD SKRSCRRRLA GHNERRRKSS  240
HDSLSRNSSQ GNKLMSGSFR SPTGRALSLL SSKAAADSWV SSPDLSSRCS AALRELIAEN  300
RAAILARHLI LDRDLHLHHV AEDPHQTAGP SSLTNNQQQT LHEQQRWGGY QETSTHFLSL  360
LQSKKYAKSS VIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-30157238384squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00161DAPTransfer from AT1G27360Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223322e-35KJ622332.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL24) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006445345.11e-145hypothetical protein CICLE_v10020532mg
RefseqXP_006464841.11e-145PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
SwissprotQ7XT422e-58SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLV4U3D11e-145V4U3D1_9R
STRINGPOPTR_0014s05690.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15613914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.42e-37squamosa promoter binding protein-like 10